PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009804326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 547aa    MW: 61221.1 Da    PI: 5.5694
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009804326.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.13.5e-1381775471374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+++L++cA+a+++++l  a++l+++l++ +s  g+p+qRl ay++e+L arla+s+s++yk+l+++e +   s+e +++++l++e++P++kf++
  XP_009804326.1 177 LKQVLIACAKAIADNNLVTAEWLMSELRTVVSVCGSPIQRLGAYMLEGLVARLASSGSSIYKSLRCKEPT---SVELMSYMHLLYEICPYFKFGY 268
                     5799*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     l aN aI++a+++e+++HiiDf+isqG QW++L++aLa+Rp+gpp++RiTg+++++s   +   +e +g+rL+++A++++vpfef++ va +++d
  XP_009804326.1 269 LSANGAIVDAMKEENTIHIIDFQISQGSQWITLIHALAARPGGPPRIRITGIDDSTSAyaRGGGIEIVGRRLSSIAASCNVPFEFHP-VAASCSD 362
                     ******************************************************998899999************************.799**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +e+e+L+v++gE laVn++l lh+++desv ++++rd++L++vkslsPk+v++veqe+++n+ +F+ rfle+l+yy ++f+s+++ lpr++++ri
  XP_009804326.1 363 VEIEHLKVRRGEPLAVNFALVLHHMPDESVGTQNHRDRLLRMVKSLSPKIVTLVEQESNTNTVQFFPRFLETLNYYLSIFESIDVALPRDHKQRI 457
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+reivn++acegaer+erhe le+Wr+r+ +aGF+p+pls+++++++k+ll+++++  y+++e++g+l+lgW++r Lv+ +aW+
  XP_009804326.1 458 NVEQHCLAREIVNIIACEGAERVERHELLERWRSRFLMAGFNPYPLSSSVNATIKTLLENYYQS-YTLDERNGALYLGWMNRDLVASCAWK 547
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.926151528IPR005202Transcription factor GRAS
PfamPF035141.2E-135177547IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MRPSQNAKDI NEFNRFYNQP VEDQESFFLP SINNPNNNQL LYADCGQQTR FSALKHNQYC  60
YVESSTGNSS ELVSDSPPVD TFFADDNSMM HQGSDSCPSD MHHSPNDTYH SSGNSSCFTS  120
DGTGLKHKLK ELETAMLGPD SESLESYNTT PLAAANQISS ESGKWVDMME MMPNGDLKQV  180
LIACAKAIAD NNLVTAEWLM SELRTVVSVC GSPIQRLGAY MLEGLVARLA SSGSSIYKSL  240
RCKEPTSVEL MSYMHLLYEI CPYFKFGYLS ANGAIVDAMK EENTIHIIDF QISQGSQWIT  300
LIHALAARPG GPPRIRITGI DDSTSAYARG GGIEIVGRRL SSIAASCNVP FEFHPVAASC  360
SDVEIEHLKV RRGEPLAVNF ALVLHHMPDE SVGTQNHRDR LLRMVKSLSP KIVTLVEQES  420
NTNTVQFFPR FLETLNYYLS IFESIDVALP RDHKQRINVE QHCLAREIVN IIACEGAERV  480
ERHELLERWR SRFLMAGFNP YPLSSSVNAT IKTLLENYYQ SYTLDERNGA LYLGWMNRDL  540
VASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-601795476375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804325.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009804326.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_016487146.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLM1C0F30.0M1C0F3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000571110.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein